PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi01g03150.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family HRT-like
Protein Properties Length: 371aa    MW: 40957.2 Da    PI: 9.804
Description HRT-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi01g03150.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HRT-like56.35.4e-18204233130
         HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmR 30 
                      iCGv+l+dG +C+r+Pv++R RC eHKGmR
  Vradi01g03150.1 204 ICGVALGDGLICRRPPVEKRLRCPEHKGMR 233
                      8****************************9 PP

2HRT-like62.65.7e-20263293131
         HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                      iCG+il+dGs+C+r+Pv+gRKRC+eHKGmRi
  Vradi01g03150.1 263 ICGIILNDGSTCRRKPVQGRKRCHEHKGMRI 293
                      8*****************************7 PP

3HRT-like62.27.5e-20335365131
         HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                      iCG+il+dGs C+rqPvkgRKRC+eHKG+Ri
  Vradi01g03150.1 335 ICGIILSDGSACTRQPVKGRKRCHEHKGRRI 365
                      8*****************************7 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:2000033Biological Processregulation of seed dormancy process
GO:0097100Molecular Functionsupercoiled DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MAALVNSRLK REQCNRTKHD SSFSHWKILI GPSDWEDHSK GKEGCPRYRI HNLPEESNPG  60
VYELGIAVSN GGLGREISKL TPHSHRILVV YLGQADNVRT RLQRYGRTGA HLQSGCSNGS  120
SSQEGRPLFE EVFSQGFSIV YRWAPKQVGI RIKSSKLAQA DDKLDEADNG SYNFLSRVFS  180
FNRSRPRIVQ STSGVVQEQE NAKICGVALG DGLICRRPPV EKRLRCPEHK GMRANVSIAE  240
SESNVSQTVV GSPVDESLTD TNICGIILND GSTCRRKPVQ GRKRCHEHKG MRIGASVQKK  300
GNGGYRYQNG SHVVEDCLQT LVGNPVDESI SNTNICGIIL SDGSACTRQP VKGRKRCHEH  360
KGRRIHASFM *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150441e-171AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014511139.10.0PREDICTED: uncharacterized protein LOC106769867
TrEMBLA0A0S3TCV00.0A0A0S3TCV0_PHAAN; Uncharacterized protein
TrEMBLA0A0L9VGN20.0A0A0L9VGN2_PHAAN; Uncharacterized protein
STRINGGLYMA07G15450.11e-160(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF94093139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56780.18e-61effector of transcription2